PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000134105
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 350aa    MW: 38413.1 Da    PI: 6.2345
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000134105genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY109.31.8e-34174231259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C+vkk+vers +dp++v++tYeg+H+h+
  MDP0000134105 174 EDGYRWRKYGQKAVKNSPFPRSYYRCTSASCNVKKRVERSFDDPSIVVTTYEGQHTHP 231
                    8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381303.7E-1071350IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.802.6E-35158233IPR003657WRKY domain
SuperFamilySSF1182908.89E-30165233IPR003657WRKY domain
PROSITE profilePS5081131.915168233IPR003657WRKY domain
SMARTSM007742.3E-41173232IPR003657WRKY domain
PfamPF031063.6E-27174231IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MDVKKDVVKR EDNNMNGGGG GCGFSTSPFA SMFDFCEGEK SSSLGFMELL GAGVGQDYCP  60
TSLFDYLPQT PSTVLPSLVS TMGGKDQFSA DYSSLNQQPA TPNSSSVSSE SSEAVNEEHT  120
DHKAAADQEE NNEEEEHDEQ KNTKKELKAK KASQKRQREP RFAFMTKSEV DHLEDGYRWR  180
KYGQKAVKNS PFPRSYYRCT SASCNVKKRV ERSFDDPSIV VTTYEGQHTH PSPLLPRPTL  240
TSASSXASAS PFAPNNFAMP LIPTRTLFPH HYQQVEPFAD NSSPPSSAPF NFGNYHVNGS  300
SSSLTNATST TTGLVHPERR FCSPATGSAL LADHGLLQDI VPSHMLKQEQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-27163233777Probable WRKY transcription factor 4
2lex_A3e-27163233777Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.68970.0fruit| leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1129110.0JX112911.1 Malus hupehensis WRKY transcription factor 23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008358182.10.0PREDICTED: probable WRKY transcription factor 23
RefseqXP_008381435.10.0PREDICTED: probable WRKY transcription factor 23
TrEMBLV9MHQ60.0V9MHQ6_9R
STRINGPOPTR_0002s19390.11e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.13e-45WRKY DNA-binding protein 23